PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019795m
Common NameEUTSA_v10019795mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 27882.8 Da    PI: 6.6751
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019795mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.32.3e-24958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krie ++nrq+tfskR++g++KKA+ELS+LCd+++a+++fs++++l  +s
  Thhalv10019795m  9 KRIEKSTNRQITFSKRKKGLIKKAYELSTLCDIDIALLMFSPSDRLCLFS 58
                     79*****************************************9997765 PP

2K-box17.31.9e-071291931377
            K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqi 77 
                      + ++l+qe+ +L+++++  ++e+R++  + +   s++e +  e++L + l+++ +++++ll ++ 
  Thhalv10019795m 129 NLQELEQEVCRLQQQLRISEEELRKFEPDPVRFTSVEEVEACETHLLNTLTRVVQRRKHLLNKSC 193
                      7899********************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.661161IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-27280IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-22323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.6E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-223859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRAKLELKR IEKSTNRQIT FSKRKKGLIK KAYELSTLCD IDIALLMFSP SDRLCLFSGQ  60
TRIEDVFARY INLPDQEREN AIVLPDQSKR LGIQNKEDLL RTLEQLKTED DMALQINEPR  120
FLSIFIFANL QELEQEVCRL QQQLRISEEE LRKFEPDPVR FTSVEEVEAC ETHLLNTLTR  180
VVQRRKHLLN KSCDVVESWR PDAEPKLAHI ITNSAHQTNW LSYDLLFQGS DSSPNQHSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17193193Myocyte-specific enhancer factor 2B
1tqe_Q2e-17193193Myocyte-specific enhancer factor 2B
1tqe_R2e-17193193Myocyte-specific enhancer factor 2B
1tqe_S2e-17193193Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0121281e-114BT012128.1 Arabidopsis thaliana At1g77950 mRNA, complete cds.
GenBankBT0123851e-114BT012385.1 Arabidopsis thaliana At1g77950 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390038.11e-177hypothetical protein EUTSA_v10019795mg
SwissprotQ1PFC21e-96AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLV4K8G31e-177V4K8G3_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.2__2429__AT1G77950.21e-135(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.21e-135AGAMOUS-like 67